Skip to content
Paramount PeptidesParamount Peptides
  • Assign a menu in Theme Options > Menus
  • Login
  • Cart / $0.00 0
    • No products in the cart.

  • 0

    Cart

    No products in the cart.

Home / Peptide Vials

LL-37 (5mg)

$75.00

SKU: PP-LL37-NC-5 Categories: Build your Kit Vials, LL-37 Collection, Peptide Vials, Single Compound Peptides Tags: Antimicrobial, GH Secretagogue Research, Metabolic Pathway Peptides, Neuropeptide Research, Peptides, pos, Tissue Modeling Research
  • Description
  • Additional information

LL-37 (5mg)

Product Specifications
CAS Number 154947-66-7
Molecular Formula C205H340N60O53
Molecular Weight (g/mol) 4493.27
Amino Acid Count 37
Amino Acid Sequence H-Leu-Leu-Gly-Asp-Phe-Phe-Arg-Lys-Ser-Lys-Glu-Lys-Ile-Gly-Lys-Glu-Phe-Lys-Arg-Ile-Val-Gln-Arg-Ile-Lys-Asp-Phe-Leu-Arg-Asn-Leu-Val-Pro-Arg-Thr-Glu-Ser-OH ([LL-37, 37 aa])
Purity ≥99% by HPLC | COA available
Physical Form Lyophilized powder
Solubility Soluble in bacteriostatic water; consult COA for specific solvent recommendations
Storage Conditions Store at -20°C; protect from light and moisture; reconstitute with bacteriostatic water

For Research Use Only. Not for use in diagnostic, therapeutic, or human or animal in-vivo procedures.

This product is sold exclusively for in-vitro laboratory research use. It is not a drug, dietary supplement, food, or cosmetic and has not been approved by the U.S. Food and Drug Administration for any use. This product is not intended to diagnose, treat, cure, mitigate, or prevent any disease. Not for human or animal consumption.

Title

Default Title

Related products

BPC-157 (5mg)
Quick View

Build your Kit Vials

BPC-157 (5mg)

$55.00
Selank (5mg)
Quick View

Build your Kit Vials

Selank (5mg)

$33.00
Single Regulator (SIA-31-C18)
Quick View

Clearance Collection

Single Regulator (SIA-31-C18)

$80.00 – $600.00Price range: $80.00 through $600.00
Epithalon (50mg)
Quick View

Build your Kit Vials

Epithalon (50mg)

$100.00
Thymosin Beta 4 (TB500) (10mg)
Quick View

Build your Kit Vials

Thymosin Beta 4 (TB500) (10mg)

$80.00
Hexarelin (5mg)
Quick View

Build your Kit Vials

Hexarelin (5mg)

$47.00
Thymalin (20mg)
Quick View

Build your Kit Vials

Thymalin (20mg)

$95.00
LL-37 (10mg)
Quick View

LL-37 Collection

LL-37 (10mg)

$100.00
© Paramount Peptides
  • Assign a menu in Theme Options > Menus
  • Login
  • Newsletter

Login

Lost your password?