P21 / BDNF (Brain-derived neurotrophic factor) (10mg)
| Product Specifications | |
|---|---|
| CAS Number | Not assigned (recombinant protein) |
| Molecular Formula | Recombinant protein; mature BDNF is 119 aa, ~13.5 kDa monomer (functions as homodimer ~27 kDa) |
| Molecular Weight (g/mol) | ~13,500 g/mol (monomer); ~27,000 g/mol (homodimer) |
| Amino Acid Count | 119 (mature) |
| Amino Acid Sequence | Mature human BDNF: HSDPARRGELSVCDSISEWVTAADKKTAVDMSGGTVTVLEKVPVSKGQLKQYFYETKCNPMGYTKEGCRGIDKRHWNSQCRTTQSYVRALTMDSKKRIGWRFIRIDTSCVCTLTIKRGR (UniProt P23560) |
| Purity | ≥99% by HPLC | COA available |
| Physical Form | Lyophilized powder |
| Solubility | Soluble in bacteriostatic water; consult COA for specific solvent recommendations |
| Storage Conditions | Store at -20°C; protect from light and moisture; reconstitute with bacteriostatic water |
For Research Use Only. Not for use in diagnostic, therapeutic, or human or animal in-vivo procedures.
This product is sold exclusively for in-vitro laboratory research use. It is not a drug, dietary supplement, food, or cosmetic and has not been approved by the U.S. Food and Drug Administration for any use. This product is not intended to diagnose, treat, cure, mitigate, or prevent any disease. Not for human or animal consumption.
| Title | Default Title |
|---|
Related products
Build your Kit Vials
3X Blend Tesamorelin (5mg) / MGF (500mcg) / Ipamorelin (2.5mg) Research Blend
$85.00
New Products
Price range: $150.00 through $700.00
Peptide Blends
$75.00
Build your Kit Vials
$100.00
Build your Kit Vials
$50.00
Build your Kit Vials
$95.00
Build your Kit Vials
$60.00
Build your Kit Vials
$65.00